 |
primary-0382 |
DHX16 |
|
DHX16 Polyclonal Antibody |
polyclonal |
Region between residue 991 and 1041 of human DEAH (Asp-Glu-Ala-His) box polypeptide 16 |
|
Thermo Fisher Scientific (Bethyl Laboratories) |
A301-537A |
|
primary-0381 |
NOLC1 |
|
Anti-NOLC1 antibody [EPR14896] |
monoclonal |
The exact immunogen used to generate this antibody is proprietary information. |
|
Abcam |
ab184550 |
|
primary-0380 |
|
AB_260015 |
Monoclonal Anti-polyHistidine antibody produced in mouse |
monoclonal |
recombinant polyHistidine tagged fusion protein |
|
Merck (Sigma-Aldrich) |
H1029 |
|
primary-0379 |
GPATCH4 |
AB_10954002 |
GPATCH4 Polyclonal Antibody |
polyclonal |
Region between residue 396 and 446 of human G Patch Domain Containing 4 |
|
Thermo Fisher Scientific (Bethyl Laboratories) |
A303-405A |
|
primary-0378 |
FLAG |
AB_439687 |
ANTI-FLAG® antibody produced in rabbit |
polyclonal |
DYKDDDDK |
|
Merck (Sigma-Aldrich) |
F7425 |
|
primary-0377 |
FBRL |
AB_640513 |
Fibrillarin Antibody (H-140) |
polyclonal |
|
|
Santa Cruz Biotechnology |
sc-25397 |
|
primary-0376 |
RPL15 |
|
RPL15 Antibody - N-terminal region |
polyclonal |
Synthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK |
|
Aviva Systems Biology Corp |
ARP65141_P050 |
|
primary-0375 |
|
AB_10917565 |
Dyskerin Antibody (H-3) |
monoclonal |
amino acids 171-470 mapping within an internal region of Dyskerin of human origin |
|
Santa Cruz Biotechnology |
sc-373956 |
|
primary-0374 |
DHX15 |
AB_2091992 |
DHX15 Polyclonal Antibody - A300-390A |
polyclonal |
Region between residue 750 and the C-terminus (residue 795) of human DEAH (Asp-Glu-Ala-His) Box Polypeptide 15. |
|
Thermo Fisher Scientific (Bethyl Laboratories) |
A300-390A |
|
primary-0373 |
COIL |
AB_2081428 |
Anti-Coilin antibody |
monoclonal |
Recombinant fragment corresponding to Human Coilin (C terminal). |
|
Abcam |
ab11822 |
|
primary-0372 |
HA |
AB_2864361 |
Anti-HA tag antibody [EPR22819-101] |
monoclonal |
The exact immunogen used to generate this antibody is proprietary information. |
|
Abcam |
ab236632 |
|
primary-0371 |
ASCC1 |
AB_2059350 |
ASCC1 Polyclonal antibody |
polyclonal |
Recombinant human ASCC1 protein |
|
ProteinTech |
12301-1-AP |
|
primary-0370 |
FLAG |
AB_259529 |
ANTI-FLAG® M2 antibody, Mouse monoclonal |
monoclonal |
DYKDDDDK |
|
Merck (Sigma-Aldrich) |
F3165 |
|
primary-0369 |
FLAG |
AB_439701 |
ANTI-FLAG® M2-FITC antibody, Mouse monoclonal |
monoclonal |
DYKDDDDK |
|
Merck (Sigma-Aldrich) |
F4049 |
|
primary-0368 |
ASC1 |
|
ASC-1 (F-7) |
monoclonal |
amino acids 282-581 mapping at the C-terminus of ASC-1 of human origin |
|
Santa Cruz Biotechnology |
sc-376916 |
|
primary-0359 |
SKP1 |
AB_11153724 |
SKP1 Monoclonal Antibody (4E11) |
monoclonal |
|
|
Thermo Fisher Scientific (Invitrogen) |
MA5-15928 |
|
primary-0358 |
UBE2D3 |
AB_11014373 |
UbcH5c/UBE2D3 Antibody |
polyclonal |
Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) |
|
Novus Biologicals |
NBP1-55276 |
|
primary-0357 |
NLRP14 |
AB_10905283 |
NLRP14 polyclonal antibody |
polyclonal |
A synthetic peptide corresponding to 16 amino acids near N-terminus of human NLRP14. |
|
Abnova |
PAB19311 |
|
primary-0356 |
UHRF1 |
AB_10947236 |
UHRF1 Antikörper (H-8) |
monoclonal |
amino acids 586-717 mapping near the C-terminus of UHRF1 of mouse origin |
|
Santa Cruz Biotechnology |
sc-373750 |
|
primary-0355 |
NALP5 |
|
Anti-NALP5 antibody |
polyclonal |
A Synthetic peptide (14 amino acid) from near the C terminus of Human NALP5 (NP_703148). |
|
Abcam |
ab105324 |
|
primary-0354 |
UQCRB |
AB_2890185 |
Recombinant Anti-UQCRB antibody [EPR15591] |
monoclonal |
Recombinant full length protein. This information is proprietary to Abcam and/or its suppliers. |
|
Abcam |
ab190360 |
|
primary-0353 |
TLE6 |
AB_2854652 |
TLE6 Polyclonal Antibody |
polyclonal |
Synthetic peptide within mouse Tle6 aa 157-206 |
|
Thermo Fisher Scientific (Invitrogen) |
PA5-109241 |
|
primary-0352 |
SPIN1 |
AB_2808250 |
SPIN1 Polyclonal Antibody |
polyclonal |
Recombinant fusion protein containing a sequence corresponding to amino acids 1-262 of human SPIN1. |
|
Thermo Fisher Scientific (Invitrogen) |
PA5-96448 |
|
primary-0351 |
DPPA5 |
AB_2277471 |
Anti-DPPA5 |
unknown |
synthetic peptide corresponding to amino acids 43-60 [RIPYIEQVSKAMLELKAL] of human DPPA5 (GeneID 340168). |
|
Sigma-Aldrich |
D2569 |
|
primary-0350 |
LONRF3 |
AB_1843962 |
Monoclonal Anti-RNF127 antibody produced in mouse |
monoclonal |
RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
|
Sigma-Aldrich |
WH0079836M1 |