Primary antibodies

Search:
AG PID Sort ascending Antigen Symbol Antibody Registry Name Clonality Antigen Quality Company Catalog no.
primary-0382 DHX16 DHX16 Polyclonal Antibody polyclonal Region between residue 991 and 1041 of human DEAH (Asp-Glu-Ala-His) box polypeptide 16 Thermo Fisher Scientific (Bethyl Laboratories) A301-537A
primary-0381 NOLC1 Anti-NOLC1 antibody [EPR14896] monoclonal The exact immunogen used to generate this antibody is proprietary information. Abcam ab184550
primary-0380 AB_260015 Monoclonal Anti-polyHistidine antibody produced in mouse monoclonal recombinant polyHistidine tagged fusion protein Merck (Sigma-Aldrich) H1029
primary-0379 GPATCH4 AB_10954002 GPATCH4 Polyclonal Antibody polyclonal Region between residue 396 and 446 of human G Patch Domain Containing 4 Thermo Fisher Scientific (Bethyl Laboratories) A303-405A
primary-0378 FLAG AB_439687 ANTI-FLAG® antibody produced in rabbit polyclonal DYKDDDDK Merck (Sigma-Aldrich) F7425
primary-0377 FBRL AB_640513 Fibrillarin Antibody (H-140) polyclonal Santa Cruz Biotechnology sc-25397
primary-0376 RPL15 RPL15 Antibody - N-terminal region polyclonal Synthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK Aviva Systems Biology Corp ARP65141_P050
primary-0375 AB_10917565 Dyskerin Antibody (H-3) monoclonal amino acids 171-470 mapping within an internal region of Dyskerin of human origin Santa Cruz Biotechnology sc-373956
primary-0374 DHX15 AB_2091992 DHX15 Polyclonal Antibody - A300-390A polyclonal Region between residue 750 and the C-terminus (residue 795) of human DEAH (Asp-Glu-Ala-His) Box Polypeptide 15. Thermo Fisher Scientific (Bethyl Laboratories) A300-390A
primary-0373 COIL AB_2081428 Anti-Coilin antibody monoclonal Recombinant fragment corresponding to Human Coilin (C terminal). Abcam ab11822
primary-0372 HA AB_2864361 Anti-HA tag antibody [EPR22819-101] monoclonal The exact immunogen used to generate this antibody is proprietary information. Abcam ab236632
primary-0371 ASCC1 AB_2059350 ASCC1 Polyclonal antibody polyclonal Recombinant human ASCC1 protein ProteinTech 12301-1-AP
primary-0370 FLAG AB_259529 ANTI-FLAG® M2 antibody, Mouse monoclonal monoclonal DYKDDDDK Merck (Sigma-Aldrich) F3165
primary-0369 FLAG AB_439701 ANTI-FLAG® M2-FITC antibody, Mouse monoclonal monoclonal DYKDDDDK Merck (Sigma-Aldrich) F4049
primary-0368 ASC1 ASC-1 (F-7) monoclonal amino acids 282-581 mapping at the C-terminus of ASC-1 of human origin Santa Cruz Biotechnology sc-376916
primary-0359 SKP1 AB_11153724 SKP1 Monoclonal Antibody (4E11) monoclonal Thermo Fisher Scientific (Invitrogen) MA5-15928
primary-0358 UBE2D3 AB_11014373 UbcH5c/UBE2D3 Antibody polyclonal Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) Novus Biologicals NBP1-55276
primary-0357 NLRP14 AB_10905283 NLRP14 polyclonal antibody polyclonal A synthetic peptide corresponding to 16 amino acids near N-terminus of human NLRP14. Abnova PAB19311
primary-0356 UHRF1 AB_10947236 UHRF1 Antikörper (H-8) monoclonal amino acids 586-717 mapping near the C-terminus of UHRF1 of mouse origin Santa Cruz Biotechnology sc-373750
primary-0355 NALP5 Anti-NALP5 antibody polyclonal A Synthetic peptide (14 amino acid) from near the C terminus of Human NALP5 (NP_703148). Abcam ab105324
primary-0354 UQCRB AB_2890185 Recombinant Anti-UQCRB antibody [EPR15591] monoclonal Recombinant full length protein. This information is proprietary to Abcam and/or its suppliers. Abcam ab190360
primary-0353 TLE6 AB_2854652 TLE6 Polyclonal Antibody polyclonal Synthetic peptide within mouse Tle6 aa 157-206 Thermo Fisher Scientific (Invitrogen) PA5-109241
primary-0352 SPIN1 AB_2808250 SPIN1 Polyclonal Antibody polyclonal Recombinant fusion protein containing a sequence corresponding to amino acids 1-262 of human SPIN1. Thermo Fisher Scientific (Invitrogen) PA5-96448
primary-0351 DPPA5 AB_2277471 Anti-DPPA5 unknown synthetic peptide corresponding to amino acids 43-60 [RIPYIEQVSKAMLELKAL] of human DPPA5 (GeneID 340168). Sigma-Aldrich D2569
primary-0350 LONRF3 AB_1843962 Monoclonal Anti-RNF127 antibody produced in mouse monoclonal RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sigma-Aldrich WH0079836M1