View primary antibody

Basic data

PID primary-0376
EPIC PID
Research group RG Bohnsack M.T.
Quality (mean) no score (0.00)
Sharing level Public

Antibody data

Antigen symbol RPL15
Antibody Registry ID(s)
Name RPL15 Antibody - N-terminal region
Alternative name
Lab ID
Tag / Fluorophore
Raised in rabbit
Reacts with cow, dog, goat, guineapig, horse, human, mouse, rabbit, rat, yeast, zebrafish
Clone
Isotype
Clonality polyclonal
Demasking unknown
Antigen Synthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK
Crafted By company
Company / Manufacturer Aviva Systems Biology Corp
Catalog no. ARP65141_P050
Lot no.
Description
Localization
Storage instruction All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Receipt date
Preparation date
Created by
Last modified

External links

Applications


No application comments yet.

Linked publications


GPATCH4 regulates rRNA and snRNA 2′-O-methylation in both DHX15-dependent and DHX15-independent manners
Kanwal N et al.
Nucleic Acids Res 2023: 10.1093/nar/gkad1202