| Antigen symbol |
RPL15 |
| Antibody Registry ID(s) |
|
| Name |
RPL15 Antibody - N-terminal region |
| Alternative name |
|
| Lab ID |
|
| Tag / Fluorophore |
|
| Raised in |
rabbit |
| Reacts with |
cow, dog, goat, guineapig, horse, human, mouse, rabbit, rat, yeast, zebrafish |
| Clone |
|
| Isotype |
|
| Clonality |
polyclonal |
| Demasking |
unknown |
| Antigen |
Synthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK |
| Crafted By |
company |
| Company / Manufacturer |
Aviva Systems Biology Corp |
| Catalog no. |
ARP65141_P050 |
| Lot no. |
|
| Description |
|
| Localization |
|
| Storage instruction |
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding. |
| Receipt date |
|
| Preparation date |
|
| Created by |
|
| Last modified |
|