 |
primary-0430 |
HMGB1 |
AB_3711424 |
Anti-HMGB1 antibody [1F3] |
monoclonal |
Recombinant Full Length Protein corresponding to Human HMGB1 |
|
Abcam |
ab190377 |
 |
primary-0424 |
|
AB_2191222 |
pan-Cytokeratin Antikörper (AE1/AE3) |
monoclonal |
epidermal keratins of human origin |
|
Santa Cruz Biotechnology |
sc-81714 |
 |
primary-0423 |
HSPA8 |
AB_627761 |
HSPA8/HSC70 Antibody (B-6) |
monoclonal |
amino acids 583-601 at the C-terminus of HSC 70 of human origin |
|
Santa Cruz Biotechnology |
sc-7298 |
 |
primary-0422 |
SF3B1 |
AB_2880946 |
SF3B1 Polyclonal antibody |
polyclonal |
Recombinant human SF3B1 protein |
|
ProteinTech |
27684-1-AP |
 |
primary-0421 |
PRP6 |
AB_10674405 |
Anti-PRP6/ANT-1 antibody |
unknown |
Synthetic Peptide within Human PRPF6 aa 1-50. The exact immunogen used to generate this antibody is proprietary information. |
|
Abcam |
ab99292 |
 |
primary-0420 |
H3K27ac |
AB_2561016 |
H3K27ac-mouse |
polyclonal |
|
|
Active Motif |
39133 |
 |
primary-0419 |
Myc |
AB_2148585 |
c-MYC Polyclonal antibody |
polyclonal |
Recombinant human MYC protein |
|
ProteinTech |
10828-1-AP |
 |
primary-0418 |
MKI67 |
AB_2142366 |
Anti-Ki-67 Antibody |
polyclonal |
Synthetic peptide from human Ki-67 |
|
Merck (Sigma-Aldrich) |
AB9260 |
 |
primary-0414 |
PARP1 |
AB_2679240 |
Anti-PARP1 antibody produced in rabbit |
polyclonal |
KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM |
|
Merck (Sigma-Aldrich) |
HPA045168 |
 |
primary-0413 |
TRMT2A |
AB_1079092 |
Anti-TRMT2A antibody produced in rabbit |
polyclonal |
LCPEAVEDARVNAQDNELSNVEFHCGRAEDLVPTLVSRLASQHLVAILDPPRAGLHSKVILAIRRAKNLRRLLYVSCNPRAAMGNFVDLCRAPSNRVKGIPFRPVKAVAVDLFPQTPHCEMLILFERVEHPNGTGVLGPHSPPAQPTPGPPDNTLQETGT |
|
Merck (Sigma-Aldrich) |
HPA001077 |
 |
primary-0412 |
PES1 |
AB_625300 |
Rabbit anti-Pescadillo Antibody Affinity Purified |
polyclonal |
Between 538 and C-terminus |
|
Bethyl |
A300-903A |
 |
primary-0407 |
NMD3 |
AB_2282830 |
NMD3 Polyclonal antibody |
unknown |
Recombinant human NMD3 protein |
|
ProteinTech |
16060-1-AP |
 |
primary-0406 |
GLTSCR2 |
AB_2880852 |
GLTSCR2 Polyclonal antibody |
polyclonal |
Recombinant human GLTSCR2 protein |
|
ProteinTech |
27353-1-AP |
 |
primary-0405 |
PPAN |
AB_2168040 |
PPAN Polyclonal antibody |
polyclonal |
Recombinant human PPAN protein |
|
ProteinTech |
11006-1-AP |
 |
primary-0404 |
GAPDH |
AB_2263076 |
GAPDH Polyclonal antibody |
polyclonal |
Recombinant human GAPDH protein |
|
ProteinTech |
10494-1-AP |
 |
primary-0403 |
LMNB1 |
AB_11232208 |
Lamin B1 Monoclonal antibody |
monoclonal |
Recombinant human Lamin B1 protein |
|
ProteinTech |
66095-1-Ig |
 |
primary-0402 |
GTPBP4 |
AB_2279486 |
GTPBP4 Polyclonal antibody |
polyclonal |
Recombinant human GTPBP4 protein |
|
ProteinTech |
13897-1-AP |
 |
primary-0401 |
GNL2 |
AB_10601655 |
Anti-GNL2 antibody produced in rabbit |
polyclonal |
sequence RIPFFVKPPNAEPLVAPQLLPSSSLEVVPEAAQNNPGEEVTETAGEGSESIIKEETEENSHCDANTEMQQILTRVRQNFGKINVVPQFSGDDLVPV |
|
Merck (Sigma-Aldrich) |
HPA027163 |
 |
primary-0400 |
GNL3 |
AB_2263303 |
GNL3 Polyclonal antibody |
polyclonal |
Recombinant human GNL3 protein |
|
ProteinTech |
15060-1-AP |
 |
primary-0399 |
GNL3L |
|
Anti-GNL3L polyclonal antibody |
unknown |
|
|
Sigma-Aldrich |
HAP036315 |
 |
primary-0398 |
|
AB_1031062 |
Normal Rabbit IgG |
unknown |
|
|
Cell Signaling Technology |
2729 |
 |
primary-0397 |
H3 |
AB_880437 |
HRP Anti-Histone H3 antibody - Nuclear Loading Control |
polyclonal |
The exact immunogen used to generate this antibody is proprietary information. |
|
Abcam |
ab21054 |
 |
primary-0395 |
SRSF2 |
AB_526734 |
SC35 Antibody (SC-35) |
monoclonal |
Partially purified mammalian spliceosome. |
|
Novus Biologicals |
NB100-1774 |
 |
primary-0394 |
SRRM2 |
AB_2647934 |
SRRM2 Polyclonal Antibody |
polyclonal |
Recombinant protein corresponding to Human SRRM2. Recombinant protein control fragment (Product #RP-98745). |
|
Thermo Fisher Scientific (Invitrogen) |
PA5-59559 |
 |
primary-0391 |
PRPF8 |
|
PRPF8 (F4D7U) Rabbit Monoclonal Antibody |
monoclonal |
synthetic peptide corresponding to residues surrounding Ala2328 of human PRPF8 protein |
|
Cell Signaling Technology |
36884 |