| Antigen symbol |
TIMM44 |
| Antibody Registry ID(s) |
AB_2204679 |
| Name |
TIMM44 Polyclonal antibody |
| Alternative name |
|
| Lab ID |
|
| Tag / Fluorophore |
|
| Raised in |
rabbit |
| Reacts with |
human, mouse, rat |
| Clone |
|
| Isotype |
IgG |
| Clonality |
polyclonal |
| Demasking |
unknown |
| Antigen |
Recombinant human TIMM44 protein |
| Crafted By |
company |
| Company / Manufacturer |
ProteinTech |
| Catalog no. |
13859-1-AP |
| Lot no. |
|
| Description |
Immunogen
CatNo: Ag4834
Product name: Recombinant human TIMM44 protein
Source: e coli.-derived, PGEX-4T
Tag: GST
Domain: 153-452 aa of BC033628
Sequence: AKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKRTEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALTDKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQLAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRMLYVWALCRDQDELNPYAAWRLLDISASSTEQIL |
| Localization |
|
| Storage instruction |
Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20°C storage |
| Receipt date |
|
| Preparation date |
|
| Created by |
|
| Last modified |
|