 |
primary-0387 |
FBRL |
AB_10916877 |
Fibrillarin Antibody (G-8) |
monoclonal |
amino acids 99-127 within an internal region of Fibrillarin of human origin |
|
Santa Cruz Biotechnology |
sc-374022 |
|
primary-0386 |
SART3 |
AB_999668 |
SART3/TIP110 Polyclonal Antibody |
polyclonal |
Region between residue 600 and 650 of Human squamous cell carcinoma antigen recognized by T-cells 3 (Tat-interacting protein of 110 kDa). |
|
Thermo Fisher Scientific (Bethyl Laboratories) |
A301-521A |
|
primary-0385 |
TUBA1B |
AB_2210206 |
Alpha Tubulin Polyclonal antibody |
polyclonal |
Recombinant human Tubulin-Alpha protein |
|
ProteinTech |
11224-1-AP |
|
primary-0384 |
CD11b |
AB_398456 |
APC Mouse Anti-Human CD11b |
monoclonal |
Human monocytes |
|
BD Biosciences |
|
|
primary-0383 |
DHX35 |
|
Anti-DHX35 antibody [EPR12383] - C-terminal |
monoclonal |
The exact immunogen used to generate this antibody is proprietary information. |
|
Abcam |
ab179442 |
|
primary-0382 |
DHX16 |
|
DHX16 Polyclonal Antibody |
polyclonal |
Region between residue 991 and 1041 of human DEAH (Asp-Glu-Ala-His) box polypeptide 16 |
|
Thermo Fisher Scientific (Bethyl Laboratories) |
A301-537A |
|
primary-0381 |
NOLC1 |
|
Anti-NOLC1 antibody [EPR14896] |
monoclonal |
The exact immunogen used to generate this antibody is proprietary information. |
|
Abcam |
ab184550 |
|
primary-0380 |
|
AB_260015 |
Monoclonal Anti-polyHistidine antibody produced in mouse |
monoclonal |
recombinant polyHistidine tagged fusion protein |
|
Merck (Sigma-Aldrich) |
H1029 |
|
primary-0379 |
GPATCH4 |
AB_10954002 |
GPATCH4 Polyclonal Antibody |
polyclonal |
Region between residue 396 and 446 of human G Patch Domain Containing 4 |
|
Thermo Fisher Scientific (Bethyl Laboratories) |
A303-405A |
|
primary-0378 |
FLAG |
AB_439687 |
ANTI-FLAG® antibody produced in rabbit |
polyclonal |
DYKDDDDK |
|
Merck (Sigma-Aldrich) |
F7425 |
|
primary-0377 |
FBRL |
AB_640513 |
Fibrillarin Antibody (H-140) |
polyclonal |
|
|
Santa Cruz Biotechnology |
sc-25397 |
|
primary-0376 |
RPL15 |
|
RPL15 Antibody - N-terminal region |
polyclonal |
Synthetic peptide located within the following region: SALHRAPRPTRPDKARRLGYKAKQGYVIYRIRVRRGGRKRPVPKGATYGK |
|
Aviva Systems Biology Corp |
ARP65141_P050 |
|
primary-0375 |
|
AB_10917565 |
Dyskerin Antibody (H-3) |
monoclonal |
amino acids 171-470 mapping within an internal region of Dyskerin of human origin |
|
Santa Cruz Biotechnology |
sc-373956 |
|
primary-0374 |
DHX15 |
AB_2091992 |
DHX15 Polyclonal Antibody - A300-390A |
polyclonal |
Region between residue 750 and the C-terminus (residue 795) of human DEAH (Asp-Glu-Ala-His) Box Polypeptide 15. |
|
Thermo Fisher Scientific (Bethyl Laboratories) |
A300-390A |
|
primary-0373 |
COIL |
AB_2081428 |
Anti-Coilin antibody |
monoclonal |
Recombinant fragment corresponding to Human Coilin (C terminal). |
|
Abcam |
ab11822 |
|
primary-0372 |
HA |
AB_2864361 |
Anti-HA tag antibody [EPR22819-101] |
monoclonal |
The exact immunogen used to generate this antibody is proprietary information. |
|
Abcam |
ab236632 |
|
primary-0371 |
ASCC1 |
AB_2059350 |
ASCC1 Polyclonal antibody |
polyclonal |
Recombinant human ASCC1 protein |
|
ProteinTech |
12301-1-AP |
|
primary-0370 |
FLAG |
AB_259529 |
ANTI-FLAG® M2 antibody, Mouse monoclonal |
monoclonal |
DYKDDDDK |
|
Merck (Sigma-Aldrich) |
F3165 |
|
primary-0369 |
FLAG |
AB_439701 |
ANTI-FLAG® M2-FITC antibody, Mouse monoclonal |
monoclonal |
DYKDDDDK |
|
Merck (Sigma-Aldrich) |
F4049 |
|
primary-0368 |
ASC1 |
|
ASC-1 (F-7) |
monoclonal |
amino acids 282-581 mapping at the C-terminus of ASC-1 of human origin |
|
Santa Cruz Biotechnology |
sc-376916 |
|
primary-0359 |
SKP1 |
AB_11153724 |
SKP1 Monoclonal Antibody (4E11) |
monoclonal |
|
|
Thermo Fisher Scientific (Invitrogen) |
MA5-15928 |
|
primary-0358 |
UBE2D3 |
AB_11014373 |
UbcH5c/UBE2D3 Antibody |
polyclonal |
Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) |
|
Novus Biologicals |
NBP1-55276 |
|
primary-0357 |
NLRP14 |
AB_10905283 |
NLRP14 polyclonal antibody |
polyclonal |
A synthetic peptide corresponding to 16 amino acids near N-terminus of human NLRP14. |
|
Abnova |
PAB19311 |
|
primary-0356 |
UHRF1 |
AB_10947236 |
UHRF1 Antikörper (H-8) |
monoclonal |
amino acids 586-717 mapping near the C-terminus of UHRF1 of mouse origin |
|
Santa Cruz Biotechnology |
sc-373750 |
|
primary-0355 |
NALP5 |
|
Anti-NALP5 antibody |
polyclonal |
A Synthetic peptide (14 amino acid) from near the C terminus of Human NALP5 (NP_703148). |
|
Abcam |
ab105324 |