| Antigen symbol |
GTPBP4 |
| Antibody Registry ID(s) |
AB_2279486 |
| Name |
GTPBP4 Polyclonal antibody |
| Alternative name |
|
| Lab ID |
|
| Tag / Fluorophore |
|
| Raised in |
rabbit |
| Reacts with |
human, mouse |
| Clone |
|
| Isotype |
IgG |
| Clonality |
polyclonal |
| Demasking |
unknown |
| Antigen |
Recombinant human GTPBP4 protein |
| Crafted By |
company |
| Company / Manufacturer |
ProteinTech |
| Catalog no. |
13897-1-AP |
| Lot no. |
|
| Description |
Immunogen
CatNo: Ag4859
Product name: Recombinant human GTPBP4 protein
Source: e coli.-derived, PGEX-4T
Tag: GST
Domain: 332-634 aa of BC038975
Sequence: KTEACDRLLAHRVETKMKGNKVNEVLNRLHLAIPTRRDDKERPPFIPEGVVARRKRMETEESRKKRERDLELEMGDDYILDLQKYWDLMNLSEKHDKIPEIWEGHNIADYIDPAIMKKLEELEKEEELRTAAGEYDSVSESEDEEMLEIRQLAKQIREKKKLKILESKEKNTQGPRMPRTAKKVQRTVLEKEMRSLGVDMDDKDDAHYAVQARRSRSITRKRKREDSAPPSSVARSGSCSRTPRDVSGLRDVKMVKKAKTMMKNAQKKMNRLGKKGEADRHVFDMKPKHLLSGKRKAGKKDRR |
| Localization |
|
| Storage instruction |
Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20°C storage. |
| Receipt date |
|
| Preparation date |
|
| Created by |
|
| Last modified |
|