View primary antibody

Basic data

PID primary-0350
EPIC PID
Research group RG Urlaub
Quality (mean) no score (0.00)
Sharing level Public

Antibody data

Antigen symbol LONRF3
Antibody Registry ID(s) AB_1843962
Name Monoclonal Anti-RNF127 antibody produced in mouse
Alternative name
Lab ID
Tag / Fluorophore
Raised in mouse
Reacts with
Clone 1D5
Isotype IgG2a κ
Clonality monoclonal
Demasking unknown
Antigen RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Crafted By company
Company / Manufacturer Sigma-Aldrich
Catalog no. WH0079836M1
Lot no.
Description Immunogen: RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQADALASRGRIREALEVY
Localization
Storage instruction −20°C
Receipt date
Preparation date
Created by
Last modified

External links

Applications


No application comments yet.

Linked publications


Mammalian oocytes store proteins for the early embryo on cytoplasmic lattices
Jentoft IM et al.
Cell 2023: 10.1016/j.cell.2023.10.003