| Antigen symbol |
LONRF3 |
| Antibody Registry ID(s) |
AB_1843962 |
| Name |
Monoclonal Anti-RNF127 antibody produced in mouse |
| Alternative name |
|
| Lab ID |
|
| Tag / Fluorophore |
|
| Raised in |
mouse |
| Reacts with |
|
| Clone |
1D5 |
| Isotype |
IgG2a κ |
| Clonality |
monoclonal |
| Demasking |
unknown |
| Antigen |
RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Crafted By |
company |
| Company / Manufacturer |
Sigma-Aldrich |
| Catalog no. |
WH0079836M1 |
| Lot no. |
|
| Description |
Immunogen: RNF127 (NP_079054, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: MESVRIEQMLSLPAEVSSDNLESAERGASAAQVDMGPHPKVAAEGPAPLPTREPEQEQSPGTSTPESKVLLTQADALASRGRIREALEVY |
| Localization |
|
| Storage instruction |
−20°C |
| Receipt date |
|
| Preparation date |
|
| Created by |
|
| Last modified |
|