View primary antibody

Basic data

PID primary-0358
EPIC PID
Research group RG Urlaub
Quality (mean) no score (0.00)
Sharing level Public

Antibody data

Antigen symbol UBE2D3
Antibody Registry ID(s) AB_11014373
Name UbcH5c/UBE2D3 Antibody
Alternative name
Lab ID
Tag / Fluorophore
Raised in rabbit
Reacts with
Clone
Isotype IgG
Clonality polyclonal
Demasking unknown
Antigen Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast))
Crafted By company
Company / Manufacturer Novus Biologicals
Catalog no. NBP1-55276
Lot no.
Description Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D3. Peptide sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF. The peptide sequence for this immunogen was taken from within the described region.
Localization
Storage instruction Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Receipt date
Preparation date
Created by
Last modified

External links

Applications


No application comments yet.

Linked publications


Mammalian oocytes store proteins for the early embryo on cytoplasmic lattices
Jentoft IM et al.
Cell 2023: 10.1016/j.cell.2023.10.003