| Antigen symbol |
UBE2D3 |
| Antibody Registry ID(s) |
AB_11014373 |
| Name |
UbcH5c/UBE2D3 Antibody |
| Alternative name |
|
| Lab ID |
|
| Tag / Fluorophore |
|
| Raised in |
rabbit |
| Reacts with |
|
| Clone |
|
| Isotype |
IgG |
| Clonality |
polyclonal |
| Demasking |
unknown |
| Antigen |
Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) |
| Crafted By |
company |
| Company / Manufacturer |
Novus Biologicals |
| Catalog no. |
NBP1-55276 |
| Lot no. |
|
| Description |
Synthetic peptides corresponding to UBE2D3(ubiquitin-conjugating enzyme E2D 3 (UBC4/5 homolog, yeast)) The peptide sequence was selected from the N terminal of UBE2D3. Peptide sequence MALKRINKELSDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVF. The peptide sequence for this immunogen was taken from within the described region. |
| Localization |
|
| Storage instruction |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Receipt date |
|
| Preparation date |
|
| Created by |
|
| Last modified |
|